PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g00219.1.p
Common NameBRADI_1g00219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 274aa    MW: 30685.6 Da    PI: 9.7678
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g00219.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS186.81.5e-57362692235
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cAeav+s+dl+ a+++L++++  +sp+gd+ qRla+yf+++L+arla+++s+ y++l  ++ts   ++e ++a++l+  ++ +lk++
  Bradi1g00219.1.p  36 EMLLIRCAEAVASNDLHSASEVLEQIKRYSSPTGDARQRLAHYFAQGLEARLAGTGSQFYRSLIGTRTS---TVELVKAYHLYDATFCFLKVA 125
                       579***********************************************************9888887...899****************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l  N+ I++av+g +++Hi+ ++i+ GlQWp L+q La R++gpp +R+  ++ p++g    e++ee g+rL+++A+++g++++f++ ++ +
  Bradi1g00219.1.p 126 FLFSNKIIYKAVAGRKKLHIVHYGINLGLQWPDLIQWLAGREDGPPVVRMISINIPQPGfsPYEQIEEAGHRLSNYASKFGMSIKFQA-ITGK 217
                       **********************************************************99999*************************.6899 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksls 235
                        e+++ e+L+++p+E+l+Vn+ +q  +l+d+s++ +   +rd vL ++++++
  Bradi1g00219.1.p 218 PEAVRAEDLHIDPDEVLVVNSLFQFRTLMDDSLKFDRvsPRDMVLGTIRKMK 269
                       ********************************99887779*********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.3419273IPR005202Transcription factor GRAS
PfamPF035145.0E-5536269IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MQEVLITLDN ENKAARKSIR MGGRRGAMQA VVTHLEMLLI RCAEAVASND LHSASEVLEQ  60
IKRYSSPTGD ARQRLAHYFA QGLEARLAGT GSQFYRSLIG TRTSTVELVK AYHLYDATFC  120
FLKVAFLFSN KIIYKAVAGR KKLHIVHYGI NLGLQWPDLI QWLAGREDGP PVVRMISINI  180
PQPGFSPYEQ IEEAGHRLSN YASKFGMSIK FQAITGKPEA VRAEDLHIDP DEVLVVNSLF  240
QFRTLMDDSL KFDRVSPRDM VLGTIRKMKL MAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-25392498218GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238972.11e-178PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3GL330.0A0A0Q3GL33_BRADI; Uncharacterized protein
STRINGBRADI4G09235.11e-139(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2273846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.16e-63SCARECROW-like 14